Lux Peptides

Lux Peptides Tesamorelin research vial, lyophilised powder

TESAMORELIN

Price range: £32.95 through £47.95

Research-grade Tesamorelin, supplied as lyophilised powder in 5 mg and 10 mg vials. For laboratory research use only. Not for human or animal consumption.

Shipped by Royal Mail, packed with ice packs to keep your order cool in transit. UK delivery £3.99.

SKU: TSM-TESAMORELIN
Category: ,
Brands:

Research reference

TESAMORELIN

Clinical trial data available

Tesamorelin is a synthetic analogue of growth hormone-releasing hormone (GHRH) made up of the full 44-amino-acid sequence with an N-terminal trans-3-hexenoyl group. It is supplied as a lyophilised powder for laboratory research applications only.

Molecular information

Type

GHRH analogue

Length

44 amino acids

Formula

C221H366N72O67S

Weight

5135.9 g/mol

CAS

218949-48-5

Form

Lyophilised powder

Vial sizes

5 mg / 10 mg

Classification

Growth hormone secretagogue

Sequence

  • 01(trans
  • 023
  • 03hexenoyl)
  • 04Tyr
  • 05Ala
  • 06Asp
  • 07Ala
  • 08Ile
  • 09Phe
  • 10Thr
  • 11Asn
  • 12Ser
  • 13Tyr
  • 14Arg
  • 15Lys
  • 16Val
  • 17Leu
  • 18Gly
  • 19Gln
  • 20Leu
  • 21Ser
  • 22Ala
  • 23Arg
  • 24Lys
  • 25Leu
  • 26Leu
  • 27Gln
  • 28Asp
  • 29Ile
  • 30Met
  • 31Ser
  • 32Arg
  • 33Gln
  • 34Gln
  • 35Gly
  • 36Glu
  • 37Ser
  • 38Asn
  • 39Gln
  • 40Glu
  • 41Arg
  • 42Gly
  • 43Ala
  • 44Arg
  • 45Ala
  • 46Arg
  • 47Leu
  • 48NH2

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Research overview

Tesamorelin binds the GHRH receptor on pituitary somatotroph cells and stimulates pulsatile growth hormone release, which in turn raises IGF-1. The hexenoyl group makes it more resistant to enzymatic breakdown than native GHRH. Research has concentrated on visceral fat, liver fat and regulation of the growth hormone axis.

Common research focus areas

  • Growth hormone axis signalling
  • Visceral adipose tissue studies
  • Hepatic fat models
  • IGF-1 regulation research

Laboratory research use only

This product is supplied strictly for laboratory research use. It is not a medicine, food, cosmetic, or dietary supplement, and is not for human or animal consumption. Any use outside a documented laboratory research protocol is prohibited.

Handling

For laboratory use, reconstitute with a sterile diluent appropriate to the research protocol, introducing the diluent slowly against the vial wall to minimise peptide degradation. Do not shake.

Published research

  • Metabolic effects of a growth hormone-releasing factor in patients with HIVFalutz J et al. · New England Journal of Medicine · 2007 · Randomised controlled trialPMID 18057338
  • Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extensionFalutz J et al. · Journal of Acquired Immune Deficiency Syndromes · 2010 · Randomised controlled trialPMID 20101189

Evidence status

Tesamorelin has been tested in randomised controlled trials in people living with HIV who have excess abdominal fat. It is approved by the US FDA for that specific use but is not authorised as a medicine in the UK. The material supplied here is for laboratory research only.

Additional information

Vial Size

5 mg, 10 mg

Related products